SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427715849|ref|YP_007063843.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427715849|ref|YP_007063843.1|
Domain Number 1 Region: 3-200,231-314
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 2.09e-91
Family ATP synthase (F1-ATPase), gamma subunit 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427715849|ref|YP_007063843.1|
Sequence length 315
Comment ATP synthase F1 subcomplex subunit gamma [Calothrix sp. PCC 7507]
Sequence
MPNLKAIRDRIQSVKNTKKITEAMRLVAAARVRRAQEQVIATRPFADRLAQVLYGLQTRL
KFEDADLPLLKKREVKTVGLLVISGDRGLCGGYNSNIIRRAENRAKELQAEGVNYKFVLV
GRKAIQYFQRRNQPIDATYTGLEQIPTAAEANKIADELLSLFLSQSVDRIELIYTKFVSL
VSSRPVVQTLLPLDPQGLEAGDDEIFRLTTRGGQFQVEREKVTTQARPLARDMIFEQDPV
QILDSLLPLYLSNQLLRALQESAASELAARMTAMNNASDNAGELIKTLSLSYNKARQAAI
TQELLEVVGGAEALT
Download sequence
Identical sequences K9PE35
WP_015126834.1.42896 gi|427715849|ref|YP_007063843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]