SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427715977|ref|YP_007063971.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427715977|ref|YP_007063971.1|
Domain Number 1 Region: 127-279
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.22e-26
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00092
Further Details:      
 
Domain Number 2 Region: 379-523
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.68e-24
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00047
Further Details:      
 
Domain Number 3 Region: 295-372
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.94e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.0028
Further Details:      
 
Domain Number 4 Region: 29-119
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.11e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427715977|ref|YP_007063971.1|
Sequence length 535
Comment precorrin-3B synthase [Calothrix sp. PCC 7507]
Sequence
MKFRDCAAAVMGLPKSECQFQGCDHLLSALHREGVSLLLSGFSACPGLFYPTPAQDGTLS
RIRIPGGSLNSRQLCAIAQIAHQCGGGYADVTNRANLQIREIHQDIDAGVMKRLQDLGLG
SSNPAVDHIRNIMTSPTAGIDSQELIDTHPFVQGWENYIATHPELSGLSAKFSVCFDGGG
IVSVCDRLNDITFAAVLIAGKVYFRLYLSVGAKGEPPSDTGILLLPKQCLPVLATLANVY
LEHTDITSRRKLRFRELLNALGCDNYLQQVQQHLPFSLFVNQQYPNITSKVSTNNYRHIG
IHPQRQPSLYYIGVVLPLGRLETRQMKGLADLAKKYGSDTIRLTPWQNLLITDIPQQWVA
DVVSELADLGLDSSPKNINSALVACSGKKGCAASATDTKSHALGLTEYLKTRVALDRPVN
IHVSGCAKSCAQHSKSDIALLGISWEENNRTTEGYHIYVGNGDCNQKFGREIYQSVAVAE
LPTLLEQMLKVYKIQRINSSESFGEFANRYAIAQLKHLFASSWQRSGSGAGGRGR
Download sequence
Identical sequences K9PF03
gi|427715977|ref|YP_007063971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]