SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427716163|ref|YP_007064157.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716163|ref|YP_007064157.1|
Domain Number 1 Region: 7-92,188-353
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.14e-45
Family Bacterial dinuclear zinc exopeptidases 0.0048
Further Details:      
 
Domain Number 2 Region: 82-196
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.0000000000000702
Family Aminopeptidase/glucanase lid domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427716163|ref|YP_007064157.1|
Sequence length 356
Comment peptidase M42 family protein [Calothrix sp. PCC 7507]
Sequence
MWDYEQLFQIIEELVMHHSPSGVETEINQFLLQRFASLGVEVWQDRADNIIAKIPGKNRE
RAMSNDKPLRVYAITAHKDEIGAIVKTIGDAGRVEVRKLGGAFPWVYGEGVVDLLGDNAT
ISGILSFGSRHVSHESPQKVQQEDTTVKWENAWIETKLTSAELETAGIRPGTRMVIGKHR
KRPIRLKDHIASYTLDNKASVAILLALAEVVKQPEADVYLVASAKEEVGAIGALFFTQNQ
TLDALIALEICPLASEYPIEDGESPVILSQDGYGIYDETLNAQLRQSAKDLDIPVQLAIL
NGFGSDASIAMKLGHVGRAACLAFPTQNTHGYEIAHLGAIANCIHLLKAFCESKFD
Download sequence
Identical sequences K9PDU7
WP_015127146.1.42896 gi|427716163|ref|YP_007064157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]