SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427716243|ref|YP_007064237.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427716243|ref|YP_007064237.1|
Domain Number - Region: 13-106
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0012
Family LacY-like proton/sugar symporter 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427716243|ref|YP_007064237.1|
Sequence length 122
Comment hypothetical protein Cal7507_0924 [Calothrix sp. PCC 7507]
Sequence
MHNTYDPDKRKLLSALSHGAIFFSTTLISVGIPIALLFTSDDPVVKENAKESINFHFNVW
FYGAILGAMFFLTGWLVLPLLLLGPLAGLGYVLHWGLTIWALTHVFSNPEVPFRYPFIFR
VF
Download sequence
Identical sequences K9PE42
WP_015127226.1.42896 gi|427716243|ref|YP_007064237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]