SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427716254|ref|YP_007064248.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427716254|ref|YP_007064248.1|
Domain Number - Region: 37-172
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0118
Family LacY-like proton/sugar symporter 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427716254|ref|YP_007064248.1|
Sequence length 185
Comment hypothetical protein Cal7507_0935 [Calothrix sp. PCC 7507]
Sequence
MSKVNRYILGVRRSRTMQIVWKDICYHLGVFYRKAFLGIRVLLMRLTSKPTAETEDKKKL
ARLNPSRVRDHLANERTYLAWMRTAIALLGFGVVIVRLRAFQAPLVPRPGTGWMLGLVFS
LVGLVTVWLSTGHYFAVRRDIEEDTYEPSDRWVLLFSLAIMILGSGVIYFVFTTPLDPLS
SVIPE
Download sequence
Identical sequences K9PF83
gi|427716254|ref|YP_007064248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]