SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427716308|ref|YP_007064302.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716308|ref|YP_007064302.1|
Domain Number 1 Region: 121-233
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 2.09e-24
Family 4'-Phosphopantetheinyl transferase SFP 0.068
Further Details:      
 
Domain Number 2 Region: 18-114
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 1.57e-22
Family 4'-Phosphopantetheinyl transferase SFP 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427716308|ref|YP_007064302.1|
Sequence length 234
Comment 4'-phosphopantetheinyl transferase [Calothrix sp. PCC 7507]
Sequence
MRNWLPAPTDLTLSPNDVHLWRINLEQTESKLEDFTASLSGDELTRAQRFYFPEHRQRFI
AGRGSLRAILGSYLGVAPSEVEFDYEPRGKPVLAEKFAKSGLAFNLSHSQGLGLLGVSDR
QIGVDLEYMRSMDDVEALANRFFLPRESELVRSLAPNQKQEIFFRYWTCKEAYLKATGEG
IAQLEQAEIYLTPTTPAKLQTSGDWSLYELVPANNYVAAVAVAGCDWDLKCWQY
Download sequence
Identical sequences K9PE97
WP_015127290.1.42896 gi|427716308|ref|YP_007064302.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]