SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427716339|ref|YP_007064333.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427716339|ref|YP_007064333.1|
Domain Number - Region: 17-64
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.00855
Family Ribosomal protein L37ae 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427716339|ref|YP_007064333.1|
Sequence length 67
Comment hypothetical protein Cal7507_1022 [Calothrix sp. PCC 7507]
Sequence
MLALLKGEVRLPQKLLFGRNQRIICPTIRQSMMMRHTCLCCSYTLLRHVRPEGIYWRCSH
CYQEMPV
Download sequence
Identical sequences K9PFE9
gi|427716339|ref|YP_007064333.1| WP_015127321.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]