SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427716532|ref|YP_007064526.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427716532|ref|YP_007064526.1|
Domain Number - Region: 150-221
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0432
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427716532|ref|YP_007064526.1|
Sequence length 377
Comment propeptide PepSY amd peptidase M4 [Calothrix sp. PCC 7507]
Sequence
MKSQKIRNLSFYLHRYIGLFVGLILIIIGLTGSLLVFEQEINRWQVSQQFGQVSPQEQRV
SMETILNNVKTTYANQPELKLRSMNMLPKNSTYTVYLKTPNDAQINVFVNPYSGAIMGDR
QWESSFWGIVFKLHYALLAGRTGEIIVGIAALLLLILSITGIILWPGWRRLINGFKIKWQ
AHPKRVNFDIHKVFGIITAVFLGLIAFTGFCWNFYDFTKPAIYAVTSTPNLPEPISKPVT
GKPPLGLAEILQKADAALPGAVTTYITFPSKPEDAFAIYKKQPQESNDYGDSAVYLDQFS
GAVLRLQNGLSLPLGDRVLNSFTPLHYGTFWGLPTRILYVFVGLAPLILSVTGWVMWSYR
RRLDTLNPTDTLEPLQR
Download sequence
Identical sequences K9PGN2
WP_015127514.1.42896 gi|427716532|ref|YP_007064526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]