SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427716707|ref|YP_007064701.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427716707|ref|YP_007064701.1|
Domain Number - Region: 11-173
Classification Level Classification E-value
Superfamily Clc chloride channel 0.000746
Family Clc chloride channel 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427716707|ref|YP_007064701.1|
Sequence length 375
Comment hypothetical protein Cal7507_1400 [Calothrix sp. PCC 7507]
Sequence
MDKTSASATSHQKRSLRLKLMTILTTWAATSKGMSTMLLGKMALKTAIASAISFAIAQAL
RSEYPFYAVIAAIIVMASTHGSTLKLGMQRLIGTAIGAISGAIFVITLGSNVWSLGVCVS
ITIFLTSYWQFNEAAKLAGYVSAIVILAHNQSPWLYAWGRFLETLLGIGVALLVNNLFFP
ASAGSELRRCLSQTLVNLEQFYGLVVEGALTGTYDRPTVDVLKTSIISSLIKGQELWKEV
RQGRTNEPPETRVNEAWEFLIRRIWEHILTMEHTILAREQDTFWQILSPQITNLAQETQS
TMLGLATAVKSQESYVSLPDIEIALTNATERLNRLPEIKGENDPIDELLRFFTFFYTMEE
VGRKLQRMAATLNQV
Download sequence
Identical sequences K9PH88
gi|427716707|ref|YP_007064701.1| WP_015127687.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]