SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427716736|ref|YP_007064730.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716736|ref|YP_007064730.1|
Domain Number 1 Region: 14-43
Classification Level Classification E-value
Superfamily Subunit XII of photosystem I reaction centre, PsaM 0.000000000144
Family Subunit XII of photosystem I reaction centre, PsaM 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427716736|ref|YP_007064730.1|
Sequence length 43
Comment Photosystem I reaction center subunit XII [Calothrix sp. PCC 7507]
Sequence
MLMLDTLFLAQVSSLSDTQVYIALVVALIPGVLAWRLATELYK
Download sequence
Identical sequences K9PG35
gi|427716736|ref|YP_007064730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]