SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427716796|ref|YP_007064790.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716796|ref|YP_007064790.1|
Domain Number 1 Region: 16-257
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000000000419
Family PP2C-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427716796|ref|YP_007064790.1|
Sequence length 260
Comment hypothetical protein Cal7507_1492 [Calothrix sp. PCC 7507]
Sequence
MNISKQIPQWRVLAASVCGTSHLKNKQLCQDAHHWQILSDDILVAAAADGAGSASQGKVG
AMVAVETAIANISIKEVTRDALADDATVQSLLTEAVLAARKAVEDEAVACNKQPQDLATT
LIVMVATPEFVAVAQIGDGLAVAKDSTGNLLALTMPDNGEYINETTFLTSPGALETAQMR
LWREAIVNVGVLTDGLQMLALNMVVSEPHKPFFFPLFDFVAKTEDKTVAKEHLVRFLRSD
RITQRTDDDLTLIIAAFNQQ
Download sequence
Identical sequences K9PG89
WP_015127774.1.42896 gi|427716796|ref|YP_007064790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]