SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427716811|ref|YP_007064805.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716811|ref|YP_007064805.1|
Domain Number 1 Region: 1-281
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.63e-75
Family Cytidylytransferase 0.0063
Further Details:      
 
Domain Number 2 Region: 246-431
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 1.67e-29
Family gamma-carbonic anhydrase-like 0.04
Further Details:      
 
Domain Number 3 Region: 636-743
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.83e-19
Family Phosphoglucomutase, first 3 domains 0.0068
Further Details:      
 
Domain Number 4 Region: 371-557
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.00000000000942
Family Phosphoglucomutase, first 3 domains 0.0035
Further Details:      
 
Domain Number 5 Region: 746-831
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.000000000105
Family Phosphoglucomutase, C-terminal domain 0.009
Further Details:      
 
Domain Number 6 Region: 531-632
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.000000000392
Family Phosphoglucomutase, first 3 domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427716811|ref|YP_007064805.1|
Sequence length 842
Comment Mannose-1-phosphate guanylyltransferase, Phosphoglucosamine mutase [Calothrix sp. PCC 7507]
Sequence
MRAVLMAGGSGTRLRPLTCDLPKPMVPILNRPIAEHIINLLKRHQITEVVATLHYLPDVL
RDYFQDGSDFGVQMTYAVEEDQPLGTAGCVKNIAELLDETFLVISGDSITDFDLTAAIEF
HKQKQSKATLILTRVPNPIEFGVVITDEEGQIRRFLEKPSTSEIFSDTVNTGTYILEPEV
LEYLPANTECDFSKDLFPLLLAKNEPMYGYIAQGYWCDVGHLDAYREAQYDALARKVKLE
FAYKEVSSGLWVGQNTYIDPTAVIETPTVIGDNCRIGARVLIEDGTIIGDNVTIGADANL
KRPIVWNGAIIGDEAHLSACVISRGTRVDRRAHVLEAAVVGSLSTVGEEAQISPGVRVWP
SKKIESGAILNINLIWGNTAQRNLFGQRGVQGLANIDITPEFAVKLGAAYGSTLKPGSKV
TVSRDQRNVSRMVTRSLIAGLMSVGIDIQNLDATAIPIARTVIPTMSVAGGIHVRVHPDR
PDYILIEFMDSKGINISKALEKKIEGAYFKEDMRRALAHEIGDVAYPSQVIDRYCTAFEK
LLHVATLSNSRAKVVIDYVYAVSGAVLPQMLDKFGADAVVLNASLNKNAVTTTDREGLLT
QLGHVVEALKANFGVQVSANGEQLILVDESGFSIRGEMLTALMVDMILTSNPRGTVVVPV
HATSAVEQVARRHDGRVIRTKANPTALMEATQRNPNVVLGGSGDTGFIFPQLHPGFDSMF
CIAKIIEMLTIQERSLATVRSELPRVIHKNYPVRCPWSAKGALMRYLVETHPAQNLELID
GVKICQPYDDSWLLVLPDASEPLVHLYANSNDRDWVDDTLRNYRTRVQTFVERQQEYHPA
EV
Download sequence
Identical sequences K9PGA4
WP_015127789.1.42896 gi|427716811|ref|YP_007064805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]