SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427716894|ref|YP_007064888.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716894|ref|YP_007064888.1|
Domain Number 1 Region: 109-312
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.47e-59
Family BC ATP-binding domain-like 0.00000464
Further Details:      
 
Domain Number 2 Region: 9-108
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.45e-28
Family BC N-terminal domain-like 0.0000732
Further Details:      
 
Domain Number 3 Region: 317-387
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 7.22e-19
Family BC C-terminal domain-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427716894|ref|YP_007064888.1|
Sequence length 389
Comment formate-dependent phosphoribosylglycinamide formyltransferase [Calothrix sp. PCC 7507]
Sequence
MTNSIKLPQKLMLLGSGELGKEFVIAAQRLGNYVIAVDRYANAPAMQVADCSEVISMLSA
EDLEAVVSKHKPDFIIPEIEAIRTEKLVEFEQRGITVIPTAAATNYTMNRDRIRELAHKE
LGIRTAKYGYATTLEELLAVSDKIGFPNVVKPVMSSSGKGQSVVQNQSEVETAWNYAIAN
SRGDTQKVIVEEFIDFEIEITLLTIKQWNAPTIFCDPIGHRQERGDYQESWQPAEITAEK
IVKSQEIAKKVTDALGGAGIFGVEFFITKDEVIFSELSPRPHDTGMVTLISQNLNEFELH
LRAILGLPIPNIDLLAPSASAVILAEEKSDSVTFAGVADALSEPDVDIKLFGKPSAHPYR
RMGVALAKGVNVQEAREKATRAASKIKLV
Download sequence
Identical sequences K9PGZ4
gi|427716894|ref|YP_007064888.1| WP_015127872.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]