SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427716997|ref|YP_007064991.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427716997|ref|YP_007064991.1|
Domain Number 1 Region: 13-67
Classification Level Classification E-value
Superfamily Rubredoxin-like 6.06e-21
Family Rubredoxin 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427716997|ref|YP_007064991.1|
Sequence length 114
Comment rubredoxin-type Fe(Cys)4 protein [Calothrix sp. PCC 7507]
Sequence
MSEQSEQAVETQELDRYECRSCGYVYEPEKGDDKYEIPSGTPFAELPLTWRCPVCSAKKQ
AFSNIGPAGQASGFRENLSYGLGVNQLTPTQKNLLIFGALGLGFLFFLSLYGLQ
Download sequence
Identical sequences K9PHZ9
WP_015127974.1.42896 gi|427716997|ref|YP_007064991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]