SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427717036|ref|YP_007065030.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717036|ref|YP_007065030.1|
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.23e-36
Family N-terminal domain of MutM-like DNA repair proteins 0.00046
Further Details:      
 
Domain Number 2 Region: 146-236
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.19e-28
Family Middle domain of MutM-like DNA repair proteins 0.0012
Further Details:      
 
Domain Number 3 Region: 232-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.27e-16
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427717036|ref|YP_007065030.1|
Sequence length 283
Comment DNA-(apurinic or apyrimidinic site) lyase [Calothrix sp. PCC 7507]
Sequence
MPELPEVETVRRGLNQLTLNREITGGDVLLDRTIAHPFSVGEFIHGIKGSAIATWHRRGK
YLLAELTPSSPSSANGWLGVHLRMTGQLLWLHRDEPLHKHTRVRLFFGDEQELRFVDQRT
FGQMWWVPPNVVVETIITGLGKLAADPFSPEFTVDYLAQKLQNRHRPIKTALLDQSVVAG
LGNIYADEALFKSGILPETLCTNLERSQIERLRIAIIQVLEASIAAGGTTFSNFLNVKGV
NGNYGGVALVYNRTGEPCRVCGNLIQRIKLGGRSSHFCSQCQQ
Download sequence
Identical sequences K9PGW6
gi|427717036|ref|YP_007065030.1| WP_015128013.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]