SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427717211|ref|YP_007065205.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717211|ref|YP_007065205.1|
Domain Number 1 Region: 551-1035
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.33e-134
Family DNA polymerase I 0.0000000302
Further Details:      
 
Domain Number 2 Region: 362-544
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.52e-45
Family DnaQ-like 3'-5' exonuclease 0.00016
Further Details:      
 
Domain Number 3 Region: 10-192
Classification Level Classification E-value
Superfamily PIN domain-like 1.96e-43
Family 5' to 3' exonuclease catalytic domain 0.0000264
Further Details:      
 
Domain Number 4 Region: 193-307
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 1.38e-31
Family 5' to 3' exonuclease, C-terminal subdomain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427717211|ref|YP_007065205.1|
Sequence length 1036
Comment DNA polymerase I [Calothrix sp. PCC 7507]
Sequence
MSQTSDSATTTRPTFILIDGHSLAFRSYFAFAKGRDGGLRTKTGIPTSVCFGFLKSLLEV
MATQQPEAITVAFDLGLPTFRHEADDTYKADRPGTPEDFVPDLKNLQELLTGFNLPIFTA
PGYEADDVLGTLAQRATAAGYKVKILTGDRDLFQLIDLDKEITVLNFSPDAWKRSTNSIT
EFGPEQVQEKMGILPSQVVDFKALCGDKSDNIPGVRGIGEKTAVQLLKAYGSLDQIYAAL
PEIKGATQKKLVDGKEDAEKSRYLASIVLDVPLEVDLAACKLTGFDKNILAPILEKLEFN
RFLDKIDELQQRFGGKVAAAPKAEIADGEEFADESVAFFSFAETQAAQKQAASPIQPRII
NTEAKLTELVSLLQKFTNPEIPVAWDTETTDLEPRNASLVGIGCCWGTKLDEMAYIPLGH
KIGENLNQDVALKLLRPILESADYPKALQNAKFDRLVLRCQGINLAGLVFDTMLASYILN
PDSKHNLSDLSQRYLGLTAKSYLDLVPKGKTIADIDIPAVADYCGMDVYSTFGLVVKLRE
ELEEIPSLYKLFLQVEQPLEEVLAEMEYTGVRIDLPYLQKFSVQLETDLARIEQIAYSSI
PASELKGYFVTIWEQNQPDLVSIKQKKYDTLPSPILKAYFHKTLKELPKIDLLDIKQKIT
DALPRDIVNLNSPEQLSELLFDILRLNSKKSRKTSSKGYYSTSADILENLQGEHPFIDAL
LEYRTLHKLYSTYVKSLPKLVRSDTQRLHTDFNQTVTDTGRLSSSNPNLQNIPIGTAFSR
QIRKAFLPEPGWLMVAADYSQIELRILAHLSQEPILLQAYQQNEDVHTVTARLIFEKEDI
TSDERRAAKTINFGVIYGMGSLKFSRSTGIDKVVANEFIKRFNERYPKVFAYLEGVKKQA
IALGYVETILGRRRYFEFTSNSLRSLKGSNPDEIDLSKLKNLGPYDAGLLRSAANAPIQG
SSADIIKIAMARLHEVLKKYQARLLLQVHDELVFEVPPQEWEELQPQIKSIMENAVQLSV
PLVVDVRAGENWMETK
Download sequence
Identical sequences K9PHH0
WP_015128185.1.42896 gi|427717211|ref|YP_007065205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]