SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427717249|ref|YP_007065243.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717249|ref|YP_007065243.1|
Domain Number 1 Region: 128-401
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.83e-107
Family BC ATP-binding domain-like 0.00000000919
Further Details:      
 
Domain Number 2 Region: 693-958
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.3e-101
Family BC ATP-binding domain-like 0.000000165
Further Details:      
 
Domain Number 3 Region: 396-553
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 3.92e-55
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000738
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.6e-50
Family BC N-terminal domain-like 0.00000218
Further Details:      
 
Domain Number 5 Region: 557-695
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.01e-44
Family BC N-terminal domain-like 0.00000462
Further Details:      
 
Domain Number 6 Region: 961-1095
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.22e-37
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427717249|ref|YP_007065243.1|
Sequence length 1098
Comment carbamoyl-phosphate synthase large subunit [Calothrix sp. PCC 7507]
Sequence
MPRRQDLRKILLLGSGPIVIGQACEFDYSGTQACKALREEGYEVVLVNSNPATIMTDPET
ADRTYIEPLTPELVEKVIEKERPDALLPTMGGQTALNLAVALAKNGVLDKYNVELIGAKL
PAIEKAEDRKLFNEAMAKIGVAVCPSGTASTLEESKAIARQIGSYPLIIRPAFTMGGTGG
GIAYNQEEFEEMAQVGIDASPVSQILIDQSLLGWKEYELEVMRDLADNVVIICSIENLDP
MGIHTGDSITVAPAQTLTDKEYQRLRDMAIKIIREIGVETGGSNIQFAVNPVNGDVVVIE
MNPRVSRSSALSSKATGFPIAKMAAKLAVGYTLDEIKNDITKKTPASFEPTIDYVVTKIP
RFAFEKFPGADPVLTTQMKSVGEAMAIGRTFNESFQKALRSLETGRAGWGCDKAEKLPSG
EQIRAQLRTPNPDRIFAVRHALQIGISNEEIYELTGIDPWFLDKMQQLLEVEKFLKRTPL
QQLTKEQMYAVKRDGYSDRQIAYATKTTEDEVRAYRQQLGINPVYKTVDTCAAEFEAFTP
YYYSTYEEETEVLPSTKPKVMILGGGPNRIGQGIEFDYCCCHAAYALKGAGYETIMVNSN
PETVSTDYDTSDRLYFEPLTKEDVLNIIEAENPVGIIVQFGGQTPLKLAVPLQKYLQGLE
PGEESAHSSCPIPQSPIPKIWGTSPDSIDMAENRERFEKILQQLNIAQPPNGIARSYEDA
LIVARRIGYPVVVRPSYVLGGRAMEIVYSDTELERYMTFAVQVEPEHPILIDKFLENAIE
VDVDAIADHTGRVVIGGIMEHIEQAGIHSGDSACSLPSISLPPAVLNQIRTWTVQLAQAL
SVVGLMNIQFAVIGASSYSPQVYILEANPRASRTVPFVSKATGVQLAKLASLIMSGKTLE
ELNFTEEVIPSHIAVKEAVLPFSKFPGTDTILGPEMRSTGEVMGIDKDFGRAFAKAEIGA
GERLPLAGTVFVSMSDRDKAAAVNVVKEFIDLGFTVMATSGTRRVLQENDLDVELVLKLH
EGRPHVLDAIKNQKIQLIINTPSGEEAQTDARLIRRTALAYKIPIITTIAGAKATVAAIH
SLQTTTLDVKSLQDYTVV
Download sequence
Identical sequences K9PI13
gi|427717249|ref|YP_007065243.1| WP_015128223.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]