SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427717308|ref|YP_007065302.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717308|ref|YP_007065302.1|
Domain Number 1 Region: 142-360
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.07e-52
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000749
Further Details:      
 
Domain Number 2 Region: 446-583
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.27e-35
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000054
Further Details:      
 
Domain Number 3 Region: 13-141
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.52e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.0034
Further Details:      
 
Domain Number 4 Region: 362-437
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.91e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.0046
Further Details:      
 
Weak hits

Sequence:  gi|427717308|ref|YP_007065302.1|
Domain Number - Region: 598-636
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.002
Family CopG-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427717308|ref|YP_007065302.1|
Sequence length 638
Comment sulfite reductase (ferredoxin) [Calothrix sp. PCC 7507]
Sequence
MVKSSPSPIAQPKPSKVEGIKENSNFLREPVATEILQDTTHFSEDSIQLLKFHGSYQQDN
RDNRVKGQEKDYQMMLRTKNPGGLVPPQLYLALDKLADEYGNHTLRATTRQGFQLHGILK
KNLKVAIATIVNNLGSTLGACGDINRNVMAPPAPFKNRPEYEYAWEYAQNIADLLSPQTG
AYYEIWLDGEKIISGEENPEVTAARQRNGNGTIIHDNPEPIYGTHYMPRKFKACVTVPGD
NSVDLYSQDLTLVVILNKKGELTGFNVYAGGGLGRTHNKEETFARLADPIGYVDKSDVYD
IVKAIVATQRDYGDRSDRRHARLKYLINDWGVDKFRAKVEEYFGKPVAPFKKLPEFKYQD
FLGWQEQGDGKLFLGISIDNGRVKDEGSFLLKTALREIVEQFNLPIRLTPHQNLIFYDIA
PENKQAIQDILDSRGVVADPNSIEPLVRFAMACPALPTCGLAITESERAIPGILDRIRAL
LDKLGLQKEHFVVRMTGCPNGCARPYMAELAFVGSAPESYQVWLGGSPNQTRLAQAYTEK
LHDNDIESFLEPIFVYFKKSKKQKESFGDFCDRVGFDAIREFTATYDPLAANSLGKSRRR
VSLKDEVYLQLKAAAESQGKPMTDLVHAALEAYFQNLP
Download sequence
Identical sequences K9PH42
gi|427717308|ref|YP_007065302.1| WP_015128282.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]