SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427717378|ref|YP_007065372.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717378|ref|YP_007065372.1|
Domain Number 1 Region: 9-466
Classification Level Classification E-value
Superfamily L-aspartase-like 2.67e-137
Family L-aspartase/fumarase 0.00000000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427717378|ref|YP_007065372.1|
Sequence length 473
Comment class II fumarate hydratase [Calothrix sp. PCC 7507]
Sequence
MTQPTDSQFRIERDSMGDRQIPGSAYYGIQTLRAIENFPISGIKPLPTYVDACLLIKKAT
AIVNGELGCIPQDISQAIVKAAEEILAGNFRDQFVVDVYQAGAGTSHHMNVNEVLANRAL
EILGDQKGNYQRVSPNDHVNYGQSTNDVIPTAIRIGGLLALAKTLHPALDQAIASLEVKA
VEFQDIVKSGRTHLQDAVPVRLGDNFGAWAQILSEHQNRIYTASGDLMVLGLGGSAAGTG
LNTHPLYRGRVVEVLTELLNSPLEPAPHLMAAMQSMSPFVNVSGALRNLAQDLVKISHDL
RLMDSGPKTGFKEIQLPPVQPGSSIMPGKYNPVMAEMTSMVCFQIMGYDNAIALAAQAGQ
LELNVMMPLIAYNLIHSIEILGNTINSLTKSCIQGITANRDRCLAYAEGSLALVTALNPH
IGYLNAAAVAKESLETGKSLRQIVLEKGLMSETELATVLNLQQMSGVSPLRAE
Download sequence
Identical sequences K9PHA2
gi|427717378|ref|YP_007065372.1| WP_015128352.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]