SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427717402|ref|YP_007065396.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717402|ref|YP_007065396.1|
Domain Number 1 Region: 262-521
Classification Level Classification E-value
Superfamily PP2C-like 1.96e-47
Family PP2C-like 0.00014
Further Details:      
 
Weak hits

Sequence:  gi|427717402|ref|YP_007065396.1|
Domain Number - Region: 16-103
Classification Level Classification E-value
Superfamily Mss4-like 0.0659
Family RabGEF Mss4 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427717402|ref|YP_007065396.1|
Sequence length 757
Comment protein serine/threonine phosphatase [Calothrix sp. PCC 7507]
Sequence
MENDAATLYCPNEHCQASNPLTHKFCQQCRTPLPKRYLWVEAEGLSVASPGEILADRYLV
ISKSVVLDTKPGFLPQMPELENLQAIKPYLRLIPYRLHIPQVYGVLPLTDGQSQKDVLLL
ERPPLVADDTGQEVQLCSQLTTAWGNATSIRQINWLWQIAHLWQPLWDEGVVSSLLDPYL
LRVEGSLVRLLELHSDPEPVPNLPQLGEFWLQLLPETRPEVAEFIQKISNSLIKEEIRST
EQLIAVLDPGLAELGRSQKPTIKIFTKTDTGRTRQRNEDACYPPSDILVSKPPQPSALAI
VCDGIGGHEGGNVASNLAIETIQQQLQQLTKIPADHIDPLQLIDDLEKAVANANDKISQR
NDSENRQGRQRMGTTLVMGLPIAHEMYITHVGDSRAYWITRHGCYQVTLDDDVASREVRL
GYAVYREAIHQSGAGSLIQALGMSPSTSLHPTTQRFILDEDAVFLLTSDGLSDFDRVEEY
WETEILPILTGESDVANVAERLIEIANDKNGHDNVTIALVHCQVKHVEPGSNLTAVIPER
FANQTVDTSRKVPDTILGSGSQKTKVIPDNKPAGSFQLPLHLIVPLILVAAAAALGYWVK
EVRSPAAKTPTPVSPSPTSQPNATVTPDVTEVPVRSLDNLAQGWVIQTTKDIKLANQATL
SSGTFLQVIEIKQNSKAAGVSLVRLRLCPNPNTPKPEVSQPIEFVQSQLKRFGNENKVTV
LPVGEKSLCDDLPPSPASKSPAPTAQNGTSVTGPDNR
Download sequence
Identical sequences K9PJ50
gi|427717402|ref|YP_007065396.1| WP_015128376.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]