SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427717414|ref|YP_007065408.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717414|ref|YP_007065408.1|
Domain Number 1 Region: 146-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.24e-125
Family Enolase 0.0000000355
Further Details:      
 
Domain Number 2 Region: 8-143
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.54e-54
Family Enolase N-terminal domain-like 0.00000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427717414|ref|YP_007065408.1|
Sequence length 429
Comment enolase [Calothrix sp. PCC 7507]
Sequence
MSNILDTAIVAIAAREILDSRGRPTIEAEVHLANGVVGLAQVPSGASTGTFEAHELRDGD
KSRYGGKGVLKAVQNVKEILAPKLLNLDVLNQELLDRTMIALDGSGNKSNLGANAILAVS
LAAAKAGAESLAIPLYRYLGGPLANLLPVPLMNVINGGAHASNNVDFQEFMIVPIGAPSF
KEALRWGAEVFATLSKVLDDKGLLTGVGDEGGFAPNLESNQVALELLVAAIDKAGYKPGE
EVALALDVAASEFYKDGQYVYDGKPHAPAEFINYLGQLVDQYPIVSIEDGLHEEDWQSWE
LITQKLGSRVQLVGDDLFVTNATRLQKGIEQKAANSILIKLNQIGSLTETLETIDLATRN
GFRSVISHRSGETEDTTIADLAVATRAGQIKTGSLCRSERVAKYNRLLRIEDELGSRAVY
AGAVGLGPK
Download sequence
Identical sequences K9PIF7
gi|427717414|ref|YP_007065408.1| WP_015128388.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]