SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427717450|ref|YP_007065444.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717450|ref|YP_007065444.1|
Domain Number 1 Region: 84-353
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.72e-76
Family BC ATP-binding domain-like 0.000000967
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily PreATP-grasp domain 8.63e-48
Family BC N-terminal domain-like 0.0000122
Further Details:      
 
Domain Number 3 Region: 332-444
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 4.87e-45
Family BC C-terminal domain-like 0.0000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427717450|ref|YP_007065444.1|
Sequence length 447
Comment acetyl-CoA carboxylase, biotin carboxylase [Calothrix sp. PCC 7507]
Sequence
MKFDKILIANRGEIALRILRACEEMGIATIAVHSTVDRNALHVQLADEAVCIGEPASIKS
YLNIPNIIAAALTRNASAIHPGYGFLSENARFVEICADHHIAFIGPTPEAIRLMGDKATA
KETMQRAGVPTVPGSDGIVESEEEGLALAKDIGYPVMIKATAGGGGRGMRLVRSEDEFVK
LYLAAQGEAGAAFGNSGVYIEKFIERPRHIEFQILADNYGNVIHLGERDCSIQRRNQKLL
EEAPSPALDSDLRDKMGEAAVKAAQFINYTGAGTIEFLLDKSGKFYFMEMNTRIQVEHPV
TEMITGIDLVAEQIRIAQGERLKLTQDQVVLRGHSIECRINAEDPDHDFRPSPGRISGYL
PPGGPGVRIDSHVYTDYQIPPYYDSLIGKLIVWGPDRPTAINRMKRALRECAITGLPTTI
GFHQRIMETPQFLQGNVSTSFVQDINS
Download sequence
Identical sequences K9PGQ9
WP_015128424.1.42896 gi|427717450|ref|YP_007065444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]