SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427717455|ref|YP_007065449.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717455|ref|YP_007065449.1|
Domain Number 1 Region: 11-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.79e-59
Family PP-loop ATPase 0.00016
Further Details:      
 
Domain Number 2 Region: 284-351
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000000288
Family MesJ substrate recognition domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427717455|ref|YP_007065449.1|
Sequence length 356
Comment tRNA(Ile)-lysidine synthase [Calothrix sp. PCC 7507]
Sequence
MVWTPLHAKIHRTIRSRQLFERNQRLLVAVSGGQDSLCLIKLLLDLQSKWGWYVAIAHCD
HRWRSDSQANAQHVENLAKIWGINFYLEIANQPVNSEASARNWRYQALSAISKTHNYQYI
VTGHTASDRAETLIYNLIRGTGADGLQALTWERPLTTGMMLVRPLLEVTRTETAQFCQEF
QLPIWEDSTNQDLKYARNRIRQELLPYLQANFNPKVESALAQTAELLQAEVEYLEQAAEK
LREEATEMTWTSTSLSPRREVSPPCSHSATLTASLPPAPLPLPLRLNRRVLQKAALALQR
RVMRQVLQQILPDAPSFEHIEKLTALIKAPNRSQTDPFPGGAIAQVEGDWIYLKQL
Download sequence
Identical sequences K9PGR1
gi|427717455|ref|YP_007065449.1| WP_015128429.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]