SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427717485|ref|YP_007065479.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717485|ref|YP_007065479.1|
Domain Number 1 Region: 487-981
Classification Level Classification E-value
Superfamily ALDH-like 3.53e-155
Family ALDH-like 0.00000000139
Further Details:      
 
Domain Number 2 Region: 129-455
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.71e-93
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427717485|ref|YP_007065479.1|
Sequence length 994
Comment L-proline dehydrogenase [Calothrix sp. PCC 7507]
Sequence
MVLQVQSSTYEAKTQEIARKILSATQENRSFLASLRDQMRWDDKLLAWAMSNPGLRVQLF
RFIDTLPALRSKSEIAAHLQEYLGDESVELPAALKGMLNFANPDSVPGQVAATTVNTAVE
TLAYKYISGENIKQVIKTVERLRKDKMAFTIDLLGEAVITEAEAQSYLERYLELMQQLVE
ASKNWTTIPAIDVADGEQLPKVQVSVKLTAFYSQFDPLDAQGSEEKVSDRIRTLLRRAQE
LGAAVHFDMEQYAYKDITFSILKKLLLEEEFRQRTDIGVTIQAYLRDSEQDAKDLITWLK
QRGYPLTIRLVKGAYWDQETIKAAQKHWPQPVYNDKVASDANFETITQLLLENHQYVYAA
IGSHNVRSQSRAIAIAESLNVPRRRFEMQVLYGMGDKLAKALVDQGYRVRVYCPYGELLP
GMAYLIRRLLENTANSSFLRQNLENRPVEELLAAPIIQESHAETQRRKEEGAGFAGVADT
DYAEEEARQKAAQAFQKVRRELGKTYLPLINGEYVNTSEVIDSLNPSNFSEVIGKVGLIS
VEQAEQAMVAAKAAFPGWRKTPAKQRADILRKAADLMEQRRAELSAWIVLEVGKPVKEAD
GEVSEAIDFCLYYAAEMERLDKGVIYDVSGETNRYIYQPRGIAVVISPWNFPLAIACGMT
VAALVAGNCTLLKPAETSSVITAKLTEILIEAGIPKGVFQYVPGKGSQVGAYLVSHPDTH
VIAFTGSQEVGCRIYAEAATLKPNQRHLKRVIAEMGGKNGIIVDESADLDQAVIGVVQSA
FGYSGQKCSACSRVIVLEPIYDTFVKRLVEATKSLNIGETELPSTQVGPVIDANARSRIL
EYIEKGKAESQLALELPAPPQGYFVGPVIFSEVPPNGIIAQQEIFGPVLAVIRVKNFQEA
LEVANGTNYALTGGLYSRTPSHIQQAQTDFAVGNLYINRNITGAIVGRQPFGGFNLSGVG
SKAGGPDYLLQFLEPRTVTENIQRQGFAPIEGVD
Download sequence
Identical sequences K9PGT9
gi|427717485|ref|YP_007065479.1| WP_015128459.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]