SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427717529|ref|YP_007065523.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717529|ref|YP_007065523.1|
Domain Number 1 Region: 114-299,434-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.53e-107
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000526
Further Details:      
 
Domain Number 2 Region: 1-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.29e-34
Family Anticodon-binding domain 0.0000896
Further Details:      
 
Domain Number 3 Region: 296-429
Classification Level Classification E-value
Superfamily GAD domain-like 8.34e-33
Family GAD domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427717529|ref|YP_007065523.1|
Sequence length 595
Comment aspartyl-tRNA synthetase [Calothrix sp. PCC 7507]
Sequence
MRTHYCGELRKKHIGETVTFYGWVDRRRDHGGVIFLDLRDRSGIVQIVSDPQRTPDSYAQ
AEALRNEYVVEITGRVTKRPEESLNPRLPTGEVEIYADKIELLNAVRKQLPFQVSTADTE
TVREDLRLKYRYLDLRRDRMAHNLQLRHQVVKAIRRYLEDVEGFIEVETPILTRSTPEGA
RDYILPSRVNPGEWYALPQSPQLFKQLLMVSGLDRYYQVARCFRDEDLRSDRQPEFTQLD
MEMSFMSQEEIIALNEQLVAHIFKTVKGIELNYPFPRLTYAEAMERYGSDKPDTRYGLEL
VNVSDVLKDSGFKVFRDAIANGGIVKILPIPHGNEAISNVRIKPGGDLFKEASEAGARGL
AYIRVREDGEIDTIGAIKDNLSAEQKAEILRRTGAKAGHLLLFGAGDTATVNKTLDRLRQ
VVAREFGLIDPEKINLLWITDFPMFEWNADEKRLEALHHPFTAPHPDDLSDLKTARAQAY
DLVFNGFEVGGGSRRIYQREIQEQVFAAIGLSPEEGQNKFGFLLEAFEYGTPPHGGIAYG
VDRLVMLLAGEESIRDVIAFPKTQQARCLLTDAPSGVDTKQLKELHVASTHQPKS
Download sequence
Identical sequences K9PIR4
WP_015128503.1.42896 gi|427717529|ref|YP_007065523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]