SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427717589|ref|YP_007065583.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717589|ref|YP_007065583.1|
Domain Number 1 Region: 318-519
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.32e-50
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000203
Further Details:      
 
Domain Number 2 Region: 900-1095
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 8.5e-44
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000726
Further Details:      
 
Domain Number 3 Region: 40-130
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.28e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0014
Further Details:      
 
Domain Number 4 Region: 136-182,296-352
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 4.01e-22
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0093
Further Details:      
 
Domain Number 5 Region: 791-877
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 9.16e-19
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0018
Further Details:      
 
Domain Number 6 Region: 641-739
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.04e-16
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0092
Further Details:      
 
Domain Number 7 Region: 183-265
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000732
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0033
Further Details:      
 
Domain Number 8 Region: 750-790,877-925
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000000366
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427717589|ref|YP_007065583.1|
Sequence length 1116
Comment acriflavin resistance protein [Calothrix sp. PCC 7507]
Sequence
MNLSEIFIRRPVMTVLVMLGILIFGLTSYRLLPVSDLPNVDYPSIQVTANLPGASPETMA
SSVATPLEQQFSSIAGLSAMNSTSSLGSTQITLQFDLNRQIDGAAQDVQAAIAKAARQLP
ANMPNPPSYRKVNPADQPILYISLNSSILPLSTVNKYADTLLAQRLSMIDGVAQVQIFGA
QKYAVRIKVDPQSLNAKGIGIDEIADAIAKGNSNLPTGTLYGTQQNATIQSNGKLNDAAD
YRSLTVAYRNGAPVQLGELGQVLDSVENDKIASWFFVGAKEPVHKEVGEKSSAQTNPQAK
SRNPGVRAILLAIQRQPGTNTVEVVDAIKKLLPDFRKQIPAAVNMDILYDRSQPIRESVT
DVQFTLLLTIVLVVLVIFLFLRNISATVIPSLAVPLSLVGTFGIMLLLGYSLDNLSLMAL
TLSVGFVVDDAVVMLENIVRHMEMGESRMEAALNASKEIGFTILSMTISLVAVFIPVLFM
GGILGRLFREFAVTISVAILVSGFISLSLTPMLCSRFLRPSHQQEETGRSGDREIRRQGD
REIESQQVGTEGVAHDSTVMTQDLPPTPNSTVSKRLRMRNLNRWLYNLSEGVFNGMLRGY
EWSLRQSLKYHRTTMVISAAILVATIYLFMVVPKGFIPSADVGQITATTQGGEDISFEEM
VKHQQAVAAIARRDPNIAAFNSSVGSAAGTNAANSGRIFISLKPREERKLNADQVVQELK
PKLSGIPGIKVFLQNPPAINIGGQQTKAQYQFTLQSPNIQELYQYAPALEAKFRTLSDLQ
DVNSDLQIKNPQVRVEINRDQASALGLTANQIETALSNAYGTRQVSTIYASDSQYQVILG
VDTQYQQDVNALDLLSIRAPSGQLVPLNAVATVKKDVGPLTINHTGQLASVTLSFNLKPG
VSLGSVTSKIEQLARATLPASISTGFQGSAQAFQSSLQGLGLLLLIAILVIYIVLGILYE
NFIHPLTILSSLPSAGFGALLTLLIFQVDLNIYAFVGIILLIGIVKKNGIMMVDFAIVAR
KQGKSPYDAIYEACVVRFRPIMMTTMAALMGTLPIALGLGAGADARRPLGLAVVGGLVFS
QFLTLYLTPVFYTYMESWQTQIKKHQWRKQPNSTAF
Download sequence
Identical sequences K9PIW9
WP_015128563.1.42896 gi|427717589|ref|YP_007065583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]