SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427717890|ref|YP_007065884.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717890|ref|YP_007065884.1|
Domain Number 1 Region: 98-190
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.7e-34
Family Imidazole glycerol phosphate dehydratase 0.000019
Further Details:      
 
Domain Number 2 Region: 13-97
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-33
Family Imidazole glycerol phosphate dehydratase 0.0000758
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427717890|ref|YP_007065884.1|
Sequence length 206
Comment imidazoleglycerol-phosphate dehydratase [Calothrix sp. PCC 7507]
Sequence
MQISERQITQISRTASVHRTTGETNVQVTINLDGTGICQAATGIPFLDHMLHQISSHGLI
DLDVQAQGDWEIDDHHTNEDVGITLGQAFSKALGDRKGIVRFGNFLAPLDEALVQVALDF
SGRPHISYGLQIPTQRVGTYDTQLVREFFVALVNHSQMTLHIRQLDGINSHHIIEATFKA
FARAMRMAVEIDTRRAGGIPSSKGVL
Download sequence
Identical sequences K9PHZ7
WP_015128862.1.42896 gi|427717890|ref|YP_007065884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]