SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427717992|ref|YP_007065986.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427717992|ref|YP_007065986.1|
Domain Number 1 Region: 216-357
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 3.27e-44
Family ATP-dependent riboflavin kinase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 13-37,68-221
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.05e-22
Family Adenylyltransferase 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427717992|ref|YP_007065986.1|
Sequence length 361
Comment riboflavin biosynthesis protein RibF [Calothrix sp. PCC 7507]
Sequence
MWVASSMEGLLTPTAVALGKFDGVHLGHQRVIQPVLQPARREGERGEEGEGGNLLERPPQ
SEKPPTSTHEHIYSTVVTFHPHPQEFFSGQPRTLLTPLDEKVEQLRSLGIEQLVLLPFDK
ELSALSPEEFVEKILVQQLQCQQISVGQDFCFGKHRTGTAEGLQLLAAKYHIPVTIVPLE
TCAGNSNLPEDNTCDHVPASDEPSISTSLIRHTLETGDIKSANLLLGRAYTLYGIVIQGQ
KLGRTIGFPTANLQLPKDKFLPRQGVYAVRVSTLNDTPNPVAAPTCLGVMNIGIRPTVNG
TDPSVEVHLFDWNGDLYGKKLAVQLVQFLRPEQKFPDLEALKTQIQLDCTVAREVLSAEW
E
Download sequence
Identical sequences K9PKT0
gi|427717992|ref|YP_007065986.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]