SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427718033|ref|YP_007066027.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718033|ref|YP_007066027.1|
Domain Number 1 Region: 35-497
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 3.14e-167
Family Type II DNA topoisomerase 0.000000000688
Further Details:      
 
Domain Number 2 Region: 535-845
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 1.06e-65
Family GyrA/ParC C-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427718033|ref|YP_007066027.1|
Sequence length 846
Comment DNA topoisomerase IV subunit A [Calothrix sp. PCC 7507]
Sequence
MAKQLNLLSTGEVITTALHTEMQRSYLEYAMSVIVGRALPDARDGLKPVHRRILYAMHEL
GLTPDRPYRKCARVVGDVLGKYHPHGDQSVYDALVRLVQDFSSRYPLLAGHGNFGSVDND
PPAAMRYTETRLAAIGHEGMLTEIGEETVEFIGNFDNSQQEPTVLPAQLPFLLLNGCSGI
AVGMATNIPPHNLGELVDGLIALIDQPDLTDEKLFELIPGPDFPTGGEIVGDSGIREAYT
TGKGSIVLRGVATLEEIPAARGSKRRTAIIITELPYQVNKAGWIEKVADLVNQSKLQGIS
DLRDESDREGMRVVIELKRDTNPQEVLQHLYHQTALQTNFGAILLALVDGQPRQLSLRQL
LQEFLHFREHTLNRRYGYELGKAENRLHLVEGLLSALSNVDEVIEILRQSPDGSTAKITL
CSRLELSEVQADAILAMPLRRLTGLELQNLQQEFEQLTEQITLLRRLLSDRKELLKALKK
DLRSLKRKYNDSRRTKLAPSSTETRKQEYSTGRLQKESDEDNSQSQISNLKSSEPPEETV
LEFTQRGYVRRSLPNAKKPKADNGLPDHDFLIQTELTDTEKDLLILTSGGKVYPVKVGDI
PAATGRSPRRTPLITMLTNTAQVAQEAVVSRFLLPDNSPTTQMILLTKQGRIKRLSLEEF
TNLTRRGVTIVKLKDDDELLFTQLTNIGEHLIVASSGGRLLRFPANDQDLPAMGRTAMGL
QALRLRKYEQMVGCVTVSKDDQLLLVTQEGYAKRIPASSLRGANRGDLGTQALKFTSKTD
NLAAMVIAMPSAGYANASAEVALVTNKERVVRIPVETVPLLNRDSKGESILQLNRDEKIM
TVAPVR
Download sequence
Identical sequences K9PJ62
WP_015129005.1.42896 gi|427718033|ref|YP_007066027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]