SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427718059|ref|YP_007066053.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718059|ref|YP_007066053.1|
Domain Number 1 Region: 220-319
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000000955
Family Multidrug resistance efflux transporter EmrE 0.012
Further Details:      
 
Domain Number 2 Region: 65-162
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000602
Family Multidrug resistance efflux transporter EmrE 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427718059|ref|YP_007066053.1|
Sequence length 352
Comment hypothetical protein Cal7507_2802 [Calothrix sp. PCC 7507]
Sequence
MTRLRRRHRLIHRISGQTYLWLAILIFGSSSAVTRKLTEIGAQHFMGGRNPISLCNVLFV
GNLCALILLILIYGKQWNKAALKQLSRKDWVSLIAVAILSGALAPGLIFQALALTGVNNV
ILVGRLEPPLTLALSVWLLRERVSFWEFMGAIAAFIGVILSIILQPQGEGMMNMGGFGLG
IGELLAAAGSIAVAISTIIGKKYLSQISLGIYSIFRTALGTVIFFFIALVLYGRDHFADV
FSPFLWQWMLLYGGLIVVVGQSFWIKGLKTSTVSVASLIGSFTPIAGLLAAYLILGEAPT
LPQYIGGSLILLGLLLSQFGIWRQTNKRFALSNVNSIPAEQQVETGMGFKGL
Download sequence
Identical sequences K9PK94
gi|427718059|ref|YP_007066053.1| WP_015129031.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]