SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427718068|ref|YP_007066062.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718068|ref|YP_007066062.1|
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily CheY-like 9.11e-29
Family CheY-related 0.0017
Further Details:      
 
Domain Number 2 Region: 145-313
Classification Level Classification E-value
Superfamily GAF domain-like 2.84e-19
Family GAF domain 0.0044
Further Details:      
 
Domain Number 3 Region: 333-495
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000017
Family PP2C-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427718068|ref|YP_007066062.1|
Sequence length 557
Comment protein serine/threonine phosphatase with GAF(s) sensor(s) [Calothrix sp. PCC 7507]
Sequence
MTETEVEKLKLMVVDDELDNLDLLYRTFRRDFKVYQASHARGALDILDKEGEMAVIISDQ
RMPEMNGTEFLSLTVERFPDTIRILLTGFTDVEDLVDAINSGQVFKYITKPWNPERLKTL
VEQATDTYRLVKKRTQELRRALRRESLYNAVTTAIRESLDYDSMLEKIVATIGQTFEATC
CLLRPVEGDRLTKDEFFYMDAQSHISSCTFDPSLLIEKVLETRHYQLTEDTYEGKTCRQL
VVPLSYQQHLLAVLALYQKGRDYPWQDEDIQLITGVTEQAALALSQAKLYQRLQEKQQQL
QNELEVARQIQHNLLRQSLPDIQGARVQASCYPAREVGGDFFEVFVHPKGDLWLAVGDVS
GKGVPAALFMASAISVLRRELSQETPAEPNVVMQNLNHAMSDDLISNNCFITLVLARYTP
STKDFVYANAGHVYPLLWSNQENGDAQPNYLKVRGVPLGILLKWEAKSGQLVLAPGDILL
LASDGITEAMVSNDVFLTEKSEHGIEPFSRSMLNQDGLWKLLQQETLPLSLNHLLARIQA
DNHVQEDDQTILSLEVL
Download sequence
Identical sequences K9PJ96
gi|427718068|ref|YP_007066062.1| WP_015129040.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]