SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427718273|ref|YP_007066267.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718273|ref|YP_007066267.1|
Domain Number 1 Region: 108-386
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.67e-67
Family Alanine racemase-like, N-terminal domain 0.004
Further Details:      
 
Domain Number 2 Region: 494-599
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000732
Family Eukaryotic ODC-like 0.011
Further Details:      
 
Weak hits

Sequence:  gi|427718273|ref|YP_007066267.1|
Domain Number - Region: 415-502
Classification Level Classification E-value
Superfamily YcfC-like 0.0562
Family YcfC-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427718273|ref|YP_007066267.1|
Sequence length 672
Comment arginine decarboxylase [Calothrix sp. PCC 7507]
Sequence
MGVESTATSDEVVKLSSSGHKAEVKSHKQKKLLPPSTTTEDLSRAWKIEDSEALYRIEGW
GQPYFSISAAGHVTVSPKGERGGSLDLFELVNSLKQRNLGLPMLIRFSDILEDRIERLNA
CFAKAIARYSYPGVYRGVFPVKCNQQRHLIEDLVKFGKPHQFGLEAGSKPELMIALAVLD
TPGALLICNGYKDQEYIETAMLAQRLGQTPIIVLEQIEEVDLVIAAHRQLGIKPILGVRA
KLSTQGMGRWGTSSGDRAKFGLTMPEVIEAIDKLRDADLLDALQLLHFHIGSQISAINVI
KDAIQEASRIYVELAMLGADMKYLDVGGGLGVDYDGSQTNFYASKNYNMQNYANDIVAEL
KDTCAERQIPVPTLISESGRAIASHQSVLIFDILSTSDVPLNPPEPPQEGESPIINYLWE
SYQSINQENYQELYHDAAQFKEEAISRFNLGILRLRERAKAERLYWACCQKILEITRQQE
YVPDELEDLEKIMASIYYINLSVFQSAPDCWAIDQLFPIMPIHRLGEEPTRRGILADLTC
DSDGKIDRFIDLRDVKSVLELHTFQPGEPYYLGMFLSGAYQEIMGNLHNLFGDTNAVHIQ
LTPKGYQIEHVVKGDTMSEVVSYVQYDSEDMVERIRQRCEHALEEKRITLAESQRLLQTY
EQSLRRYTYLNS
Download sequence
Identical sequences K9PJX1
gi|427718273|ref|YP_007066267.1| WP_015129243.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]