SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427718321|ref|YP_007066315.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718321|ref|YP_007066315.1|
Domain Number 1 Region: 172-440
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.32e-69
Family Extended AAA-ATPase domain 0.0000000366
Further Details:      
 
Domain Number 2 Region: 427-618
Classification Level Classification E-value
Superfamily FtsH protease domain-like 8.63e-65
Family FtsH protease domain-like 0.00000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427718321|ref|YP_007066315.1|
Sequence length 646
Comment membrane protease FtsH catalytic subunit [Calothrix sp. PCC 7507]
Sequence
MPVETNNKSQIKPPKWRQFGGSFLVLLTLLLLLNLIVPSFFGSRLPQVPYSDFIVQVEAG
KVDKAIVGSDRIQYSLKTQTPDGQPTEQVFTTTPVAIDLDLPKILREHNVEFAAPPPDQN
GWIGTLLSWVAPPLIFFGIWGFLMNRQGGGGPAALTVGKSKARISSDGSTGVKFTDVAGV
DEAKAELEEIVDFLKNATKYTNLGAKIPKGALLVGPPGTGKTLLAKAIAGEAGVPFFSIS
GSEFIELFVGVGAARVRDLFEQAKKQAPCIVFIDELDALGKSRGGAGGFVGGNDEREQTL
NQLLTEMDGFDANTGVIIIAATNRPEVLDPALRRPGRFDRQIVVDRPDKIGREAILNVHA
RNVKLADDVNLATIAIRTPGFAGADLANLVNEAALLAARKNRQAVVMADFNEAIERLVAG
LEKRSRILNETEKKTVAYHEVGHAIIGALMPGAGNVEKISIVPRGVGALGYTIQMPEEDR
FLMIEDEIRGRIATLLGGRSAEEIVFGKVSTGASDDIQKATDLAERAITIYGMNDKLGPV
AFEKVQQQFIEGYGNPRRSISPKVAEEIDREVKLTLDNAHHIALSILQQNRDLLEETAQE
LLQKEVLEGSQLRDRLQQAIAPDDMAEWLRTGKLSADKPLLQSILN
Download sequence
Identical sequences K9PKK9
WP_015129291.1.42896 gi|427718321|ref|YP_007066315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]