SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427718388|ref|YP_007066382.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718388|ref|YP_007066382.1|
Domain Number 1 Region: 8-432
Classification Level Classification E-value
Superfamily Clc chloride channel 2.35e-104
Family Clc chloride channel 0.00000118
Further Details:      
 
Domain Number 2 Region: 442-567
Classification Level Classification E-value
Superfamily CBS-domain pair 4.3e-33
Family CBS-domain pair 0.00064
Further Details:      
 
Domain Number 3 Region: 595-726
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.26e-18
Family Universal stress protein-like 0.01
Further Details:      
 
Domain Number 4 Region: 732-860
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000000452
Family Universal stress protein-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427718388|ref|YP_007066382.1|
Sequence length 865
Comment Cl- channel voltage-gated family protein [Calothrix sp. PCC 7507]
Sequence
MSLPVLTQRFRSLWQPRRGLAIAEASIIGLVAALSAVFLKVGSGWLGTWRVHSTHFLPAW
VALPLVGMSFGFLAGWLVQRFAPEAAGSGIPQVKASLANVPVNLSWRVALIKLLSAIITL
GSGLTLGRQGPTVHVGAGLAAGLSRWVPTSPDHRRQMIAAGAGAGLAAAFNAPIAGVLFI
VEELLHDLSGLTLGTAIIASFIGGVISRLLGGGSLDLNLKLVQSSSQFSIPEIPFFLLLG
ILAGLLGALFNLGLVFSIKTYRRLHVSLPLRVALAGLVSGMIVAILPESFRDNTGLREYV
ITGEANASLVAIAFVAQFILTLLAFGSGAPGGLFAPSLILGSTLGCLVGIGEGHILGDSS
PATYALAGMGGFFSAVSKVPITAIVIVFEMTTDFNLVLPLMIVSVTSYLIAEKVVPGSLY
EKLLLLNGINLTQEVSVEGILAKLTARDVMQQRVETLDAEMTIDEARLAFARSHHRGFPV
VEDNKLVGIVTQSDLLKMRERNLDNDTALREIMTSSPVTVTPIHNLSNVLYLLDRYQISR
LPVVERRKLIGIITRADIIRAEADHLNGENATPGLRPEPSYVVYQTRSPNIGRGRLLVTV
ANPETAATLLQMAAAIARDRHYEIECIQIMLVSRHISPSETPVRTAKSRRLLRQAEVLAK
KWKIPIHTQIRVAHDVAQAILEAINERHIDLILMGWKGNTSTPGRIFGNVVDTIIRQATC
EVVLVKLGSQHSFHRWLVPMAGGPNARLAVKLLPALVTLGNDPQIRLTRVFKPAELAPDM
TVLEQAISQLIRRRKLSSTVIALPVKADSVSQGIINLVKTEGYDVVVLGASREGLLQQAI
QGNIPEAIASGVDSTVILVRGAISS
Download sequence
Identical sequences K9PK66
gi|427718388|ref|YP_007066382.1| WP_015129358.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]