SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427718404|ref|YP_007066398.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718404|ref|YP_007066398.1|
Domain Number 1 Region: 12-269
Classification Level Classification E-value
Superfamily YjeF N-terminal domain-like 5.23e-59
Family YjeF N-terminal domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 248-527
Classification Level Classification E-value
Superfamily Ribokinase-like 1.8e-57
Family YjeF C-terminal domain-like 0.000058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427718404|ref|YP_007066398.1|
Sequence length 532
Comment hypothetical protein Cal7507_3156 [Calothrix sp. PCC 7507]
Sequence
MQNRQEKISQIVVTAEQMRDIEGRIFAAGMPVAALMEKVAGLIARRIQEIIPQINSRVGI
LIGPGHNGADALVVARELHFRGYEVLLYNPFSKLKELTSQHLQYAQSLGIPSYQTINSSA
ALTVNSERSRTVEELPDCDLIIDGLFGFGLERNLTGAIATAINQLNERHQPIISIDLPSG
LHTDTGKVLGTAIRATHTFCLGLWKLGLLQDQALDYVGKAELIDFDIPLADVQAVLGDAR
KIRRITKATALATLPLPRPPVTHKYKEGHLLLICGSRRYAGGAILTALGARASGVGMLSI
AVPESLKPLLVSHLPESLIIGCPETETGAIAQLQLPENNHLNSFSAIACGPGLTQDTTPI
VQQAIASECPLILDADGLNILANLGTIPTLKKRQAITILTPHTGEFKRLFPDIPDANQDR
IKTVQAAAAQSGAIILLKGARTAIANPQGAVWINPESTPALARGGSGDVLTGLLGGLLAQ
GVKRNIPVEDIVATAAWWHSQAAILAAQERTELGVDAFTLTQYLLRVLHLVK
Download sequence
Identical sequences K9PLA3
WP_015129373.1.42896 gi|427718404|ref|YP_007066398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]