SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427718542|ref|YP_007066536.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718542|ref|YP_007066536.1|
Domain Number 1 Region: 355-542
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.18e-63
Family Pyruvate oxidase and decarboxylase PP module 0.0000595
Further Details:      
 
Domain Number 2 Region: 1-168
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.42e-53
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000216
Further Details:      
 
Domain Number 3 Region: 182-370
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.32e-39
Family Pyruvate oxidase and decarboxylase, middle domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427718542|ref|YP_007066536.1|
Sequence length 547
Comment acetolactate synthase [Calothrix sp. PCC 7507]
Sequence
MNTAELLVQCLENEGVQYVFGLPGEENLHVLEALKNSSIQFITTRHEQGAAFMADVYGRL
TGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLDLVAMFAP
VTKWNKQIVRPSITPEVVRKAFKVAQTEKPGAVHIDVPENIAAMPVEGKALRKDNIQKTY
AAFASIRAAAAAISQAVNPLILVGNGAIRAQASDAVTQFATQMNIPVANTFMGKGVIPYT
HHLALWSVGLQQRDFITCGFDNTDLVIAIGYDLIEFSPKKWNSDGKIPIIHIAANSAETD
SSYIPSIEVVGDISDSLNEILRLADRQGKSNPYAISLRGNIRADYEEHAHDDGFPIKPQK
LIYDLRQVMGPDDIVISDVGAHKMWIARHYHCHSPNTCLISNGFAAMGIAIPGALAAKLV
HPNRKVVAATGDGGFMMNCQELETALRVGTPFVTLIFNDGGYGLIEWKQENHFGPGHSSF
VRFGNPDFVKLAESMGLKGYRVESATDLIPVLKEALAQDVPAVIDCPVDYRENRRFTQKA
GDLNCGV
Download sequence
Identical sequences K9PMD2
WP_015129511.1.42896 gi|427718542|ref|YP_007066536.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]