SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427718669|ref|YP_007066663.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718669|ref|YP_007066663.1|
Domain Number 1 Region: 6-161
Classification Level Classification E-value
Superfamily RNase III domain-like 2.96e-34
Family RNase III catalytic domain-like 0.00053
Further Details:      
 
Domain Number 2 Region: 119-233
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.23e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427718669|ref|YP_007066663.1|
Sequence length 237
Comment RNAse III [Calothrix sp. PCC 7507]
Sequence
MSLAYPRRQRQLESLVKKLGLPKEAPIQWQLLDLALTHPTVSESANYEQLEFVGDAVVRL
VAAVVLWEHYPECPVGDFAAIRSVLVSDRILAQLAREYGWELYLLVAGSATADKVGQESR
LADAFEAVLGALYLSTNNLELIRPWLDPHFKQLAAEIRLDPARLNYKAALQEWTQAHFKV
LPEYRVVEITQPHRNQERFVAEVWLHDKQLGQGKGRSIKAAEQAAAKVAFLAIPSQE
Download sequence
Identical sequences K9PM29
WP_015129638.1.42896 gi|427718669|ref|YP_007066663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]