SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427718740|ref|YP_007066734.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718740|ref|YP_007066734.1|
Domain Number 1 Region: 87-166
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.56e-24
Family Translational machinery components 0.00035
Further Details:      
 
Domain Number 2 Region: 16-83
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.24e-19
Family Ribosomal S5 protein, N-terminal domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427718740|ref|YP_007066734.1|
Sequence length 175
Comment 30S ribosomal protein S5 [Calothrix sp. PCC 7507]
Sequence
MATGRRKANRAKKEETNWQERVIQIRRVSKVVKGGKKLSFRAIVVVGNERGQVGVGVGKA
SDVIGAVKKGVADGKKHLIDIPITKSNSIPHPIDGTGGGAKVMMRPAAPGTGVIAGGAVR
TVLELAGVRNVLAKQLGSNNPLNNARAAVNALSTLRTLSEVAEDRGVPIENLYII
Download sequence
Identical sequences K9PKI3
gi|427718740|ref|YP_007066734.1| WP_015129707.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]