SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427718883|ref|YP_007066877.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718883|ref|YP_007066877.1|
Domain Number 1 Region: 30-267
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.8e-69
Family Alanine racemase-like, N-terminal domain 0.0000101
Further Details:      
 
Domain Number 2 Region: 259-394
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.5e-49
Family Alanine racemase 0.0000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427718883|ref|YP_007066877.1|
Sequence length 395
Comment alanine racemase [Calothrix sp. PCC 7507]
Sequence
MLSSKQISGVASHQECDTYAWFSQRAWVEIDLAALSQNVQQVAGFLSPSTKLMAVVKADA
YGHGAVTVAQTALESGASWLGVATVPEGIQLREGGIKAPILILGATHTPEQIQAIAHWKL
QPTLCSPKQALIFANTLETIKFNSPIPVHIKLDTGMSRLGTNWEQAAEFVQLVKRLPHLT
VASIYSHLATADSPDTTVMREQHQRFEEAIAQITALGIELPCLHLANSAATLTDSALHYD
IVRVGLAVYGLYPSTHLQNTIRLQPVLQLKARVTQVKTIASGTGVSYGHQFIAPRELRLA
VVGIGYADGVPRNLSNKMQVLIRGQRLPQIGTITMDQLMVDVSSIPDLQEGEVVTLLGAQ
GQEQISADDWAKELNTISWEILCGFKHRLPRVAVM
Download sequence
Identical sequences K9PLM1
WP_015129850.1.42896 gi|427718883|ref|YP_007066877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]