SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427718965|ref|YP_007066959.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718965|ref|YP_007066959.1|
Domain Number 1 Region: 10-89
Classification Level Classification E-value
Superfamily gp5 N-terminal domain-like 0.00000000000146
Family gp4 N-terminal domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427718965|ref|YP_007066959.1|
Sequence length 177
Comment hypothetical protein Cal7507_3734 [Calothrix sp. PCC 7507]
Sequence
MNATGTMKNFYGKYRGTVVQNIDPELRGRLLIIVPDVLGLVPSSWAEPCVPLAGPTGPPM
GVYLVPPIGAGVWVEFEHGDPEKPIWVGCRWDQPANVPPLAHAGLPVSPNIVLQTAGQNS
LVISDLPGPTGGIMLKSLTGATIIVNDTGIYIQNGKGASLTLIGPTITINNGALTIT
Download sequence
Identical sequences K9PL32
WP_015129932.1.42896 gi|427718965|ref|YP_007066959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]