SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427718974|ref|YP_007066968.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427718974|ref|YP_007066968.1|
Domain Number 1 Region: 221-463
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.37e-69
Family Leukotriene A4 hydrolase catalytic domain 0.0012
Further Details:      
 
Domain Number 2 Region: 21-214
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 5.89e-47
Family Leukotriene A4 hydrolase N-terminal domain 0.0009
Further Details:      
 
Domain Number 3 Region: 557-848
Classification Level Classification E-value
Superfamily ARM repeat 3.17e-26
Family PBS lyase HEAT-like repeat 0.019
Further Details:      
 
Weak hits

Sequence:  gi|427718974|ref|YP_007066968.1|
Domain Number - Region: 838-869
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.085
Family Mitotic arrest deficient-like 1, Mad1 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427718974|ref|YP_007066968.1|
Sequence length 874
Comment membrane alanyl aminopeptidase [Calothrix sp. PCC 7507]
Sequence
MSQSYFDTDNNDRKPFELPGAKPHYNPDRPGQVEHIFLDISLDIPNQRYDASCLISLSPI
RNGIDRLTLDAVNLNIKFVHIDQVSQGFDYDGEKLSIHLSEPTQLGKQLLIDITYTAEKP
QRGIYFIQPDKHYPNKPTQVWTQGEDEDSRFWFPCFDYPGQLSTSEIRIRVPKPLTAISN
GELIDTKNDGDYKIYHWSQQQVHPTYLMTLAIGDFAEIQDEWRGLPVTYYVEKGREEDAK
RSMGKTPRMIEFLSEKYGYIYPFPKYAQVCVDDFIFGGMENTSTTLLTDRCLLDERASLD
NRNTESLVVHELAHQWFGDLLVIKHWSHAWIKEGMASYSEVMWTEHEYGAQEAAYYRLLE
ARSYFSEDSSRYRRPMVTHVYREAIELYDRHIYEKGSCVYHMMRAELGEELFWLAMQTFV
QDNAHKTVETVDLLRAIEKATGRNLTFLFDQYVYRGGHPDFKVAYAWDGDANLAKVTITQ
TQASKENNSTSDLFDLKIPIGFGYTQQNSNPELSTQNSELRTFVVRVNEREQSFYFPLTE
KPQFVSFDVGNNFLKTVSLEYPVPELKAQLEFDPNPTARIYAAEALAKKGGLEAIKALSA
ALQNDSFWGVRVEVAKQLAEIKLDQAFDGLIPGLKDKSAFVRRSVVEALAKTKTLESYKA
VKGLIQDGDRSYYVEAAAARAIGTIAAANLDEKPKEEKVIKLLKSVLESKAGWNEVVRSG
AIAGLAELKISEPALNLVLEYTKIGTPQPLRLSAIRALGKISVGQTPVNLERILERLAEL
AKETFFLTQVAVLTALGQMETPKAIGILRSLADQTADGRVRRYADEEIAQLQKNIGSESA
LRQLREELDQLKQQNQELKSRLENLEAKSQNTAS
Download sequence
Identical sequences K9PMW0
gi|427718974|ref|YP_007066968.1| WP_015129941.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]