SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427719018|ref|YP_007067012.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427719018|ref|YP_007067012.1|
Domain Number - Region: 21-95
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0238
Family Group I mobile intron endonuclease 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427719018|ref|YP_007067012.1|
Sequence length 123
Comment plasmid stabilization system [Calothrix sp. PCC 7507]
Sequence
MAFQVRTTQTADAQIEAAYLWLREYNPAYADQWFRGLMNAIASLQEKPRRCILALEHEVF
SEEVRQLIYGKSRNTYRILFTIRDRTVYVLYVRHTILDFGFWILDFRLTPRNQVRGLLIN
FRF
Download sequence
Identical sequences K9PLZ9
gi|427719018|ref|YP_007067012.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]