SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427719184|ref|YP_007067178.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427719184|ref|YP_007067178.1|
Domain Number 1 Region: 140-204
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000396
Family N-acetyl transferase, NAT 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427719184|ref|YP_007067178.1|
Sequence length 290
Comment hypothetical protein Cal7507_3957 [Calothrix sp. PCC 7507]
Sequence
MAEARLRKQPNSNYGKSKVIAVTDGLNSLCYMTPSNLTDITTTVKEWQKQIKANPKLFST
NYTKFLSSKFAQVNITSLKTFTLNSYVDGILNSYEEFENSISEADDLSDLRFLRGDDATI
YSLATVRRSKRLLNSSCATLNEPMPWLDFFLVNPIFLNQGIGKLTIQYIIADIGHRIASQ
IYVDSAGFFEKQGFKLVIYNKHYDADFYIAENLTSPLIVYNISVSIPDGEYCNRVIDVAC
SSNQGIEYALSKVKQVYPNSSGVYWEDIESNKIYSVGADGSVVEYDSNST
Download sequence
Identical sequences K9PNK9
gi|427719184|ref|YP_007067178.1| WP_015130149.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]