SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427719341|ref|YP_007067335.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427719341|ref|YP_007067335.1|
Domain Number 1 Region: 44-343
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.45e-36
Family Filamentous hemagglutinin FhaB, secretion domain 0.024
Further Details:      
 
Domain Number 2 Region: 839-952
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000169
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 
Domain Number 3 Region: 420-581,617-646
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000267
Family iota-carrageenase 0.067
Further Details:      
 
Weak hits

Sequence:  gi|427719341|ref|YP_007067335.1|
Domain Number - Region: 702-802
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0012
Family Collagen-binding domain 0.012
Further Details:      
 
Domain Number - Region: 954-1057,1092-1112
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0534
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427719341|ref|YP_007067335.1|
Sequence length 1229
Comment filamentous hemagglutinin family outer membrane protein [Calothrix sp. PCC 7507]
Sequence
MAKNWLVLVSRVLAIAIAFIYPSTKVCAQNITLDGSLGTRETLTGPNYTIPQSAGQTVGN
NLFHSFGKFNLNSNEAAIFQNADNIRNILSRVTSGSQSLIDGLIRTQSGVNLFLINPSGI
IFGKNARLDVGGSFVASTANSLKFPDNLEFSATNNLQQPPLLSINVPIGLQYGKQQPGEI
TLQGQGNSELRVTPGNSLILAGGKINVNQFKLFAPGGKIELAGIAGDGIVDLQVNSNDVD
LSLPQKIGQADVTLKNSTLDITADSGRGIKINARNLDLSNSNISSQTQGKGDAGSVLLQT
VGSIFLRNSSISSVTYGQGNSGNISLTAKGAIFFDTSSISTSTPSGLGDAGKISLQANGS
IAFVGGGIFSDVAYGRGSGGSISLVAGDSILVTQGVTFDSEAISDRSGAGNILFQAGNSV
VISDNSRIYSTTGGKGDAGRINLQARSFSLLNGSELVSTTSNEGKGGDIEINTTDAVNIS
GLYPDGSLLKYSSIRSNAIADATAKKAGDIKITTQTFQLSDAAVLNAGTSSSARGGDITI
NSRTVEITGGAKLLTSTFGFNGGNAGNITINASEKIAILGSDRNYFPQQQARQSYLYFND
QISPASGLFSNTTPGSNGNGGRISLQTPTLLLANGATVVTSTIGSGKAGDIYLGSPDEPI
KQITISGANTGFFANTQASSITLPLKFITVNEIGEAGQLPSTAQKIPTIGTFVEKISGSL
DSSNDVDLYQIELEGNQTFSAETFVSNVRDTRLFLFDSNGIGVYANDDTIFSSFDSYQSS
LPPKHPLTPKNPGTYYLAITQYPITAVSNGGEVFSFLTPTEISGATGKGGSLPLSGWIGD
GFEQDKYTILLRGLTARPQILPGGDGGNITVHAASLIVKDSAQLTTSTSGNGKAGNITIN
AVDSINLLGSSSGVYANTTPGSSGNGGNIIIDPKNMIIRDGAKIAVDSQGEGIGGNIELA
AGILTLNNGTISAETRSSTGGNITLNLQDLLLLRNGSKISTTAGNNQFAGNSGNININSK
FIVAVPNENSDISANAFTGTGGKVTINATGIYGITPRSREELVKLLGTNKPQDLDPAKLF
TSDITAISQTSPILNGDVILNTPDLDPTRGLTVLPTNLVDVSKQIAQGCTPKGKIASHFT
STGRGGLPLNPDEPLRGRAVMTNWVTLGEGNQQIREITNKSTPETIIEAQSWVINSDGKV
ELVAYVPGSTFNNSSLLSNLSCNAFPSSQ
Download sequence
Identical sequences K9PNG9
WP_015130304.1.42896 gi|427719341|ref|YP_007067335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]