SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427719375|ref|YP_007067369.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427719375|ref|YP_007067369.1|
Domain Number 1 Region: 83-352
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.72e-68
Family BC ATP-binding domain-like 0.00000519
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.3e-47
Family BC N-terminal domain-like 0.0000266
Further Details:      
 
Domain Number 3 Region: 330-441
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.51e-36
Family BC C-terminal domain-like 0.00021
Further Details:      
 
Domain Number 4 Region: 626-752
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.31e-30
Family PH0987 C-terminal domain-like 0.01
Further Details:      
 
Domain Number 5 Region: 912-1044
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.06e-26
Family PH0987 C-terminal domain-like 0.0011
Further Details:      
 
Domain Number 6 Region: 797-889
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 5.23e-20
Family PH0987 N-terminal domain-like 0.0028
Further Details:      
 
Domain Number 7 Region: 1117-1194
Classification Level Classification E-value
Superfamily Single hybrid motif 1.27e-16
Family Biotinyl/lipoyl-carrier proteins and domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427719375|ref|YP_007067369.1|
Sequence length 1199
Comment urea carboxylase [Calothrix sp. PCC 7507]
Sequence
MFKKVLIANRGEIACRIIRTLDSLGIASVAVYSEADANATHVAAAGEAVCVGAAAAAQSY
LRIDAILEAAKATGADAIHPGYGFLSENADFALACAEAGIIFIGPSSEQIQQFGLKHQAR
NLAQQAGLPLVPGTPLLDTLAQVEEAAAEIGYPVMIKSTAGGGGIGMQLCRQAENLADAL
ETVQRLSRNNFNQSGVFLEKYIERSRHIEVQIFGDGKGNVVALGERDCSTQRRNQKVIEE
APAPNINDELRQSLYSAAIKLGKSVNYQSAGTVEFIYDVDTAEFYFLEVNSRLQVEHGVT
ESITGVDLVEWMVRLAQGESLSLDTYRYQPQGHAIQVRVYAEDPNKNFQPSSGILTNVQF
PDDVRCDRWIVTGTNVSSYYDPLVAKIIVHGESRENAIAKLQIALENSRIDGIETNLEYL
RQIVSSTEFTQGNITTKFTSSFNYHARTIDVLVAGTMTSIQDYPGRIGYWDIGVPPSGPM
DSLAFRLGNRILNNPESAAGLECTLSGPTLRFNTDTVICLTGARMKATLDKQPIPYYTAV
IVKAGSTLRLGNIQGNGFRTYISVLGGFDVPDYLGSKSTFALGNFGGHGGRALQVGDVLK
LYQVANNQVEIQSLPAELISNYPNHWDIGVMYGPHGAADFFTEASIDTIFNTDFEVNYNS
ARTGIRLNGPKPNWARQDGGDAGLHPSNLHDNAYAIGAINFTGDMPIILGLDGPSLGGFV
CPITIVQAELWKIGQLKPGDKIRFRHRTFAEALQQELQQDEQIKTLQVGQSIATVNEDVR
NPAILATITDTQIAVAYRQAGDKYVLIEYGPPVLDLNLRFRVHALMTALQTNAIAGIIEL
TPGVRTLQVHYDSRIISQPDLMRVLQDIEARLPAIADMAVPTRILHLPMSWNDETTQLAI
DRYMQSVRADAPWCPSNIEFIRRINGLGSVEEVRDIVFSASYLVLGLGDVYLGAPAAVPV
DPRHRLVTTKYNPARIWTAEGTVGIGGSYMCIYGMDSPGGYQLVGRTLPIWNCYNQTGDF
IEGKPWLLRFFDQVQYYPVSNAELTKLREDFRAGKFKLDVEETTFNLREYQQFLQDIAAE
AATFKTRQQIAFREERDRWALSAQDESDIATPETPPSTAVEIPDDCYALTAATTGNVWQV
LVKTGDRVTEETGVIVLEAMKQEMTLLPDEPGTVVEVLCEPGKLVTAGQVLAIIRQEGS
Download sequence
Identical sequences K9PMA1
WP_015130337.1.42896 gi|427719375|ref|YP_007067369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]