SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427719425|ref|YP_007067419.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427719425|ref|YP_007067419.1|
Domain Number 1 Region: 305-604
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 9.02e-90
Family DNA repair protein MutS, domain III 0.00000114
Further Details:      
 
Domain Number 2 Region: 606-851
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.21e-55
Family ABC transporter ATPase domain-like 0.000000844
Further Details:      
 
Domain Number 3 Region: 141-205,235-317
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 9.68e-43
Family DNA repair protein MutS, domain II 0.00038
Further Details:      
 
Domain Number 4 Region: 27-139
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 2.62e-35
Family DNA repair protein MutS, domain I 0.0000765
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427719425|ref|YP_007067419.1|
Sequence length 863
Comment DNA mismatch repair protein MutS [Calothrix sp. PCC 7507]
Sequence
MTASHSEIQPTEPNTPTAPHADTRLVDRSRLSKMYQHYVEMKDKYPHALLLYRVGDFFET
FFQDAVTVSRELELVLTSKHGGEVGRVAMTGVPHHAWERYTTMLVEKGYAVVICDQVEDS
ADAIGLVRREVTRILTPGTLLEEGMLKSSRNNYLAAVVIASNHWGLAYADISTGEFLTTQ
GSDLEHLTQELMRLQPAEVLFPTNAPDLGTLLRPGETSPYLPPCLPPSFCYSLRSQHPFS
QNEARPRLLQKFKVRSLEGLGCDHLPLAVRAAGGLLEYIEDTQKENSVPLQLLRTYTVTD
YLIVDHQTRRNLEITQTVRDGTFHGSLLWALDRTSTAMGGRALRRWLLQPLLDTKGIRAR
QDTIQELVENTALRQDLRQLLRQIYDLERLTGRAGSGTANAKDLVALADSLSRLPELSRL
VDQAHSPFLKALQKVPPILEDLAQKLHNNIVESPPIHIKEGSLIRSGVNPLLDERKATVE
ADQQWIANLEVDERAKTGIPTLKVGFNKTFGYYISISRAKADQVPVNYIRKQTLTNEERY
ITPELKEREARILSARDDLNQLEYEIFVELREEVGSQAEVIRNLSRAVAAADVLCGLADL
AVHQGYCRPEMLVGREIGIVDGRHPVVEQSLPAGFFVPNSTQLGQESLTNDQRQMTNDNP
DLIILTGPNASGKSCYLRQVGLIQLMAQTGSFVPARFAKLGVCDRIFTRVGAVDDLATGQ
STFMVEMNETANILNHATSRSLVLLDEIGRGTATFDGLSIAWAVAEYLATDIQSRTIFAT
HYHELNELAGMLENVANYQVTVKELPDQIIFLHQVQPGGADKSYGIEAGRLAGLPAVVIQ
RAKQVMGQIEKHSKIAMGLQNLD
Download sequence
Identical sequences K9PME6
WP_015130387.1.42896 gi|427719425|ref|YP_007067419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]