SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427719555|ref|YP_007067549.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427719555|ref|YP_007067549.1|
Domain Number 1 Region: 401-601
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.87e-66
Family Pyruvate oxidase and decarboxylase PP module 0.0000126
Further Details:      
 
Domain Number 2 Region: 218-393
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.73e-65
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000315
Further Details:      
 
Domain Number 3 Region: 26-208
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.11e-64
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427719555|ref|YP_007067549.1|
Sequence length 630
Comment acetolactate synthase large subunit [Calothrix sp. PCC 7507]
Sequence
MRSLSRTSSPQTENHVQSKTSIPSPVTPKRASGGFALLDSLQRHGVEHIFGYPGGAILPI
YDDLYKVVATGGVKHILVRHEQGASHAADGYARATGKVGVCFGTSGPGATNLVTGIATAY
MDSIPMVVVTGQVPRASIGTDAFQETDIYGITLPIVKHSYVVRDPKDMARIVAEAFHIAS
TGRPGPVLIDVPKDVALEEFDYVPVEPGSIKLPGYRPTVKGNPRQINAALQLICDSRRPL
LYVGGGAIASGAHEEIKELAELFNIPVTTTLMGIGVFDEHHPLALGMLGMHGTAYANFAV
TDCDLLICVGARFDDRVTGKLDEFASRAKVIHIDIDPAEVGKNRVPEVPIVGDVRRVLID
LLRRCKQTGTKATPNQNQEWLNLINRWRDEYPLEVPHHPDSISPQEVIVEIGSQAPHAFY
TTDVGQHQMWAAQFLKNGPRRWISSAGLGTMGFGVPAAMGAKVAFPDDEVICISGDASFQ
MCLQELGTLAQYGINVKTVIINNGWQGMVRQWQQAFYGERYSCSNMEVGMPDVELLAQAY
GIKGMVISKREELKDAIAQMLAHNGPVVVDVRVTRDENCYPMVAPGKSNAQMIGLPKQPP
KASIEPVYCSHCHAKNLPTHNFCSECGTKL
Download sequence
Identical sequences K9PMR6
gi|427719555|ref|YP_007067549.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]