SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427719900|ref|YP_007067894.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427719900|ref|YP_007067894.1|
Domain Number 1 Region: 11-291
Classification Level Classification E-value
Superfamily Folate-binding domain 2.83e-92
Family Aminomethyltransferase folate-binding domain 0.000000848
Further Details:      
 
Domain Number 2 Region: 283-373
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 2.62e-29
Family Aminomethyltransferase beta-barrel domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427719900|ref|YP_007067894.1|
Sequence length 375
Comment aminomethyltransferase [Calothrix sp. PCC 7507]
Sequence
MVNQEEIAQSLLQTPLYQLSVELKARFTSFGGWEMPVQFAGISREHEAVRNAAGMFDISH
MGKFTLQGKSLISQLQLLVPSDLSRLQPGQAQYTVLLNSQAGIIDDIIVYYQGEDSKEIQ
QAVIIVNAATTDKDKAWLLQHLDLEQIQFQDISREKVLIAVQGPKAINYLQQFVQADLKP
IKAFGHLETTILGKPGFLARTGYTGEDGFEVMLDPEVGVELWQRLNNAGVIPCGLGARDT
LRLEAAMALYGQDIDDNTTPLEAGLGWLVHLDTKGDFIGRAVLAQQKAEGVQRRLVGLQM
SGRNIARHGYKVLSAGEVVGEVTSGTLSPTLGYPVALAYVPAHLASVGQQLEVEIRGKAY
PASVVKRPFYRAKKG
Download sequence
Identical sequences K9PNQ2
WP_015130857.1.42896 gi|427719900|ref|YP_007067894.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]