SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427720007|ref|YP_007068001.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427720007|ref|YP_007068001.1|
Domain Number 1 Region: 891-1078
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 1.31e-54
Family PurM N-terminal domain-like 0.00043
Further Details:      
 
Domain Number 2 Region: 682-921
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 9.12e-52
Family PurM C-terminal domain-like 0.0000184
Further Details:      
 
Domain Number 3 Region: 18-161
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 1.79e-40
Family PurM N-terminal domain-like 0.0000202
Further Details:      
 
Domain Number 4 Region: 1082-1260
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 7.33e-39
Family PurM C-terminal domain-like 0.0037
Further Details:      
 
Domain Number 5 Region: 160-277,602-641
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.09e-25
Family Intein (protein splicing domain) 0.04
Further Details:      
 
Domain Number 6 Region: 465-545
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000486
Family Group I mobile intron endonuclease 0.085
Further Details:      
 
Domain Number 7 Region: 639-678
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 0.00000224
Family PurM N-terminal domain-like 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|427720007|ref|YP_007068001.1|
Domain Number - Region: 379-433
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00595
Family Group I mobile intron endonuclease 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427720007|ref|YP_007068001.1|
Sequence length 1268
Comment phosphoribosylformylglycinamidine synthase 2 [Calothrix sp. PCC 7507]
Sequence
MTATSPAPFSPQEIAAEGLKPEEYAEIVRRLGRHPNKAELGMFGVMWSEHCCYKNSRPLL
KQFPTTGSRILVGPGENAGVVDLGDGLELAFKIESHNHPSAVEPFQGAATGVGGILRDIF
TMGARPIALLNSLRFGSLEDAKTQRLFQGVVAGISHYGNCLVGNETFIWRDQAGVHFDTI
GNFVESRLSSDQTTLELDDAIAPETLSLDPDTHTSCWQRVRRVFKRRTQTLVTIRTALGR
TLTVTPDHPILMRSKGSWDTCTAQSLQVGDEIPILTSLPEIASAETIPPLDLIATLNPDD
ATGRDVFVKLPETWQATALIRTALQLLEPSVSKRHQYLTYGKLPLAHFLSLEPLLKVSRQ
EICLFRRGKANYMRAVIQPDAEFARLLGYYLSEGCTSQNGNTYKIIFTFAHHESEYVNDV
VSALKHLGLRPCVETRTATIAVYATSWLFGHLLKNVWQCGNRASNKACPAFVFTWPSSLQ
REVLKGLLRGDGSLTTKTHGNHAKISFATTSHKLFEQTLMLIQNQGAIPYIYQRSPSTGQ
IEGRHHQRLPLWQLEVSNFAGLTALANVFATERTAQLATALARYEGTKYSFPRFRNFSDA
VVVVQIKSIETNTVDECDVYDVEVDNTHLFVTTSGIVTHNCVGVPTVGGEVYFDPAYAGN
PLVNVMALGLMETSEIVKSGASGLGNPVLYVGSTTGRDGMGGASFASAELSDQSIDNRPA
VQVGDPFLEKSLIEACLEAFKTGAVVAAQDMGAAGITCSTSEMAAKGGVGIELDLDKIPV
RELGMVPYEYLLSESQERMLFVAHKGREQELIDIFHRWGLQAVVAGMVIADPIVRILFQG
GVAAEIPADALAENTPLYHRELLTEPPEYARKAWEWSSDALPPATTAGIEIQGSLQSWND
ILLTLLDTPTIASKNWVYRQYDHQVQNNTVILPGGADAAVVRLRPIEQVPNPKSKIQNLK
SAVAATVDCNPRYVYLDPYEGAKAVVAEAARNLSCVGAEPLAVTDNLNFGSPEKPIGYWQ
LAEACRGLAEGCRELATPVTGGNVSLYNETLDSQGNPQPIYPTPVVGMVGLIPDLNKICG
QAWQAVGDVIYLLGLPGSNITLGASEYLATIHGTVAGIPPRVDFDWERRVQKVCREGIRT
GWVRSAHDCAEGGLAVALAECAIAGNFGAEITLEIPENQPPRLDEVLFGEGGGRILVSVA
PAQQEIWESYLTENLGKEWQKIGTVANYEQGLGVLTSNNQTLIKVSIKDVSDRYSQAIAK
RLAIHATT
Download sequence
Identical sequences K9PRH7
gi|427720007|ref|YP_007068001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]