SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427720093|ref|YP_007068087.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427720093|ref|YP_007068087.1|
Domain Number 1 Region: 47-148
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000000106
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 
Domain Number 2 Region: 206-310
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000000222
Family Multidrug resistance efflux transporter EmrE 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427720093|ref|YP_007068087.1|
Sequence length 349
Comment hypothetical protein Cal7507_4900 [Calothrix sp. PCC 7507]
Sequence
MQLKLSASRFPLGTIFLIAPFFLWGTAMVAMKGVIPHTTPLFMAGVRLLPAGVLILIAAA
IMGKPSPQGWAAWLWIALFGLVDGTLFQGLLAEGLVRTGAGLGSVMIDSQPLAVALLSLW
LFQEHIGFWGWLGLGLGVLGISLIGLPDEWIFHFLDSGADITIGSWEQLLDSGEWLMLLA
ALSMAVGTVLIRFVTKYTDPVVATGWHMILGGLPLWGMSSVFESQQWQNLTTSNFLALGY
ATVFGSAIAYGLFFYFASSGSLTSLSSLTFLTPIFALLFGNLFLSEVLTPLQWFGVSLTL
VSIYLINQRDTLAGEKTTTQQQQILEPSIAEKINPITISVRESEPEISP
Download sequence
Identical sequences K9PQ58
gi|427720093|ref|YP_007068087.1| WP_015131048.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]